PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0071ss00600.2
Common NameLR48_Vigan192s000700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 202aa    MW: 22823.2 Da    PI: 4.8475
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0071ss00600.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.9e-071445132
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                       +g+WT+ Ed++l ++++ +G g W+  +++ g
  Vang0071ss00600.2 14 KGAWTALEDKILTEYINVHGEGKWRHLPKRAG 45
                       79**************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-10543IPR009057Homeodomain-like
SuperFamilySSF466899.36E-7845IPR009057Homeodomain-like
PROSITE profilePS500906.667955IPR017877Myb-like domain
CDDcd001670.001221647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGRSPCCSKE GLNKGAWTAL EDKILTEYIN VHGEGKWRHL PKRAGVQHDQ NLKNQEWQYD  60
KGSCLVQTKA TRWSKVTVSD EISHHNDEDN KSNVGDHSKM KAFLVSPSSE SKNDPVLNFM  120
ENLEMDGSFF SELLKMDFPE SSCQGNKILE DNDNPSSVEK GYLSPKSSCE TTHFSWGDSL  180
YDPNFEFLPV TTFTETGFDW L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515267.11e-108PREDICTED: myb-related protein 308-like
TrEMBLA0A0L9T6S21e-113A0A0L9T6S2_PHAAN; Uncharacterized protein
STRINGGLYMA16G00931.17e-72(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.16e-17myb domain protein 29
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]